20% OFF shipping at yvanlemoine-films.com on orders over $79 + up to 10% OFF products
yvanlemoine-films.com
home > Streptavidin, Recombinant, His-Tag | High Purity & Activity > Streptavidin, Recombinant, His-Tag | High Purity & Activity
download picture
Streptavidin, Recombinant, His-Tag | High Purity & ActivityRecombinant Streptavidin is a homo tetrameric protein variant (core streptavidin, amino acids 13 139) produced in E. coli and purified using proprietary chromatographic techniques. Consisting of a single, non glycosylated polypeptide chain of 136 amino acids, it includes an N terminal His Tag and features a molecular mass of 14. 4 kDa (approximately 57. 7 kDa per tetramer). Streptavidin is widely used in molecular biology due to its extraordinarily
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Streptavidin is a homo-tetrameric protein variant (core streptavidin, amino acids 13-139) produced in E. coli and purified using proprietary chromatographic techniques. Consisting of a single, non-glycosylated polypeptide chain of 136 amino acids, it includes an N-terminal His-Tag and features a molecular mass of 14.4 kDa (approximately 57.7 kDa per tetramer).

Streptavidin is widely used in molecular biology due to its extraordinarily high affinity for biotin ($\text{K}_\text{d} \approx 10^{-14} \text{ mol/L}$). Because it lacks carbohydrate modifications and maintains a near-neutral pI, it yields significantly lower non-specific binding compared to native avidin.

Key Features & Applications:

  • High Affinity & Stability: The streptavidin-biotin complex remains exceptionally stable across broad pH and temperature ranges.

  • Versatile Workflows: Ideal for affinity protein purification, immunoassays, Western blotting, ELISA detection, histochemistry, FISH, and cellular imaging.

  • Convenient Tagging: Equipped with an N-terminal His-Tag for seamless detection or secondary immobilization.

Specifications:

  • Activity: Greater than 16 U/mg (1 unit binds 1 µg of D-biotin).

  • Storage Buffer: 40 mM Phosphate buffer (pH 7.2), 120 mM NaCl, 0.05% Tween 20, 20% glycerol.

  • Formulation Sequence: MHHHHHHKLAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS

  • Catalog Numbers: STR-301-1 (1 mg), STR-301-5 (5 mg), STR-301-25 (25 mg), STR-301-100 (100 mg).

  • Intended Use: For research use only (RUO).

Streptavidin, Recombinant, His-Tag | High Purity & Activity

Item no : 53652640883
sold recently : Login >>
US$ 275.00
Pay in 4 interest-free payments of $68.75 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Enjoy 20% off shipping

US$ 275.00

1-11

US$ 247.50

12-35

US$ 192.50

36-59

US$ 165.00

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches